PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 405aa    MW: 44737.4 Da    PI: 5.6522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42183.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17130175147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ede+l+++v+q+G+ +W++Ia+ +  gR++k+c++rw++ 
       KHN42183.1 130 RGHWRPAEDEKLKELVAQYGPQNWNLIAENLE-GRSGKSCRLRWFNQ 175
                      899*****************************.***********996 PP

2Myb_DNA-binding54.92e-17182225146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
       KHN42183.1 182 RRSFSEEEEERLLTAHRMYGNK-WAMIARLFP-GRTDNAVKNHWHV 225
                      6789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.309125176IPR017930Myb domain
SMARTSM007173.3E-15129178IPR001005SANT/Myb domain
PfamPF002491.3E-16130175IPR001005SANT/Myb domain
SuperFamilySSF466892.21E-28130223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-26131183IPR009057Homeodomain-like
CDDcd001673.28E-14133174No hitNo description
PROSITE profilePS5129426.608177231IPR017930Myb domain
SMARTSM007174.9E-15181229IPR001005SANT/Myb domain
PfamPF002492.3E-14182224IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-20184229IPR009057Homeodomain-like
CDDcd001672.13E-7193224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MSSSQHLNNV GEDSSSRDMS FFPPSSLYVG SSQTQTPPLS LSHGNGVEGS NSNPEMGLLI  60
FASTVFQQPQ ECRGTKRAID EEEEEEEEDE EEEEGVDEIE NNKNLCLKLG GDEAQAAKSS  120
ASGKTKLCAR GHWRPAEDEK LKELVAQYGP QNWNLIAENL EGRSGKSCRL RWFNQLDPRI  180
NRRSFSEEEE ERLLTAHRMY GNKWAMIARL FPGRTDNAVK NHWHVIMARR QREHSSRVYR  240
RRKLVVNETV LPKGLNLTLS NNNAGSESTI SSTIDESAST CTNLSLTPPS SAKVTPPFGR  300
LFDHHGPSQN HHQAFGSLIG QAIGDVSFNK KFCGASWNGV AYKKAEQVGK LKGVDQSNFS  360
DANSEVSVSE SVATNRSNVS ISEESETVGD KINMPFIDFL GVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-331302307107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311830.0KT031183.1 Glycine max clone HN_CCL_37 MYB/HD-like transcription factor (Glyma03g00980.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576303.10.0PREDICTED: myb-like protein AA
TrEMBLA0A0B2SBQ80.0A0A0B2SBQ8_GLYSO; Transcription factor MYB44
STRINGGLYMA03G00980.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.11e-66myb domain protein 117
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]